Homepage | Set Home | Add to Favorites
Member

Cangzhou Yatai Commercial & Trade Co . Ltd


Search
 

Friends links
  • No link

Browse by Showcase | Browse by List Products
Picture Heading Updated
Catfish Food
Model Number: Catfish Food Brand Name: YATAI Key Specifications/Special Features: Fish foodProtein: 30% minMoisture: 8% maxAsh: 12% maxCrude fiber: 12% maxAppearance: brown yellowPacking: 25kg/bag, PP bags with PE linersLoading quantity:1*20''...
2017-10-25
Soybean meal for animal feed, protein 42-46 pct
Model Number: YT118 Brand Name: yatai Key Specifications/Special Features: High quality soybean mealProducts information:Crude protein: 42%minMoisture: ≤10%Crude fat: ≤10%Certificate: PONY SGSStorage: stored in a cool, ventilated and dry placePa...
2017-09-22
High Quality Floating Fish Feed Pellet for Catfish
Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat...
2017-08-19
   Home   Next   Previous   Last